PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family VOZ
Protein Properties Length: 591aa    MW: 64572.2 Da    PI: 5.6042
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23555genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ410.72.8e-1262584751217
       VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsl 100
               p+ps++lgpkcalwdc rp++gse++qdyc+ +ha lal + gl+gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+cegaat+kspwna elfdlsl
  EMT23555 258 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALSDdGLLGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCEGAATSKSPWNAHELFDLSL 358
               89*************************************87699********************************************************* PP

       VOZ 101 legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvs 201
               lege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+eyein++++lalyrle+k +d k+s+k+k+ 
  EMT23555 359 LEGESLREWLFFDRPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEYEINDSNTLALYRLEFKASDPKRSVKSKLG 459
               ***************************************************************************************************** PP

       VOZ 202 kdsladlqkklgrlta 217
               ++sl+++q+++++l+a
  EMT23555 460 SSSLNEIQQQMVKLSA 475
               **************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MAGDPTGGGG GSAAGKGPRS STRHQQFRDR AKTRVDDLQE IFSGLQSARK ESRSADAAVL  60
EEQVHQMLRE WRAELSVASP ASSLQVPLQT LAFPPLACSG TRCAPPAEPR RLRQLAIDEE  120
DDATSKLAQP MQPSRQDGHQ NLNPGLQVHG GTVDGGADAS QQSMGHGMQG EVADVANALF  180
SDQMYYIDHE LSIDDFLHGS NPDGLNNLQG TGQPEHQQFN LPLDLQHSNN SYADANNSVQ  240
STGDVFFHMS DLLTTVGPSP SQYLGPKCAL WDCGRPVRGS EECQDYCNPY HAGLALSDDG  300
LLGTRPVMRP RGIDLKDGPL FDALCAKVQG KNVGIPVCEG AATSKSPWNA HELFDLSLLE  360
GESLREWLFF DRPRRAFESG NRKQRSLPDY NGRGWHESRK QVMKDFGGLK KSYYMDPQPS  420
SNYEWHLFEY EINDSNTLAL YRLEFKASDP KRSVKSKLGS SSLNEIQQQM VKLSANSPVD  480
NKRGARSKTK ASQKDTNANT YPALKTTNQA GASNAYEAVP LNIPNQASAP NAYQTVAPSI  540
PNQDSTSNAY EDASQVDPMS YLNENVVYGP HLPYGYPDGK GDFYWNPSGG A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
TrEMBLM8BF340.0M8BF34_AEGTA; Uncharacterized protein
STRINGBRADI2G19820.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-136vascular plant one zinc finger protein